Lineage for d4kwha_ (4kwh A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349962Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1349963Protein automated matches [190069] (159 species)
    not a true protein
  7. 1351230Species Streptomyces cyanogenus [TaxId:80860] [235237] (2 PDB entries)
  8. 1351231Domain d4kwha_: 4kwh A: [236593]
    automated match to d4kwia_
    complexed with acy, nap, peg

Details for d4kwha_

PDB Entry: 4kwh (more details), 1.7 Å

PDB Description: The crystal structure of angucycline C-6 ketoreductase LanV with bound NADP
PDB Compounds: (A:) Reductase homolog

SCOPe Domain Sequences for d4kwha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kwha_ c.2.1.0 (A:) automated matches {Streptomyces cyanogenus [TaxId: 80860]}
gnltgktalvtgasrgigraiaeklgyagalvavhyatgadaaaevaesiekdggraftv
kaelgvpgdvdvlfeglerglkertgatdldilvnnagvmamgapeevtpemfdrmmavn
akapffivqralsvmpdggriinvssgltrvaspdqvtygmskgaleqialhfsrhlgsr
ritvnsvapgstdngsalfqipevretlsqlstfgevaepaaiadvvaflasedarwitg
afidasggtllg

SCOPe Domain Coordinates for d4kwha_:

Click to download the PDB-style file with coordinates for d4kwha_.
(The format of our PDB-style files is described here.)

Timeline for d4kwha_: