| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Streptomyces cyanogenus [TaxId:80860] [235237] (3 PDB entries) |
| Domain d4kwha_: 4kwh A: [236593] Other proteins in same PDB: d4kwhb2 automated match to d4kwia_ complexed with acy, nap, peg |
PDB Entry: 4kwh (more details), 1.7 Å
SCOPe Domain Sequences for d4kwha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kwha_ c.2.1.0 (A:) automated matches {Streptomyces cyanogenus [TaxId: 80860]}
gnltgktalvtgasrgigraiaeklgyagalvavhyatgadaaaevaesiekdggraftv
kaelgvpgdvdvlfeglerglkertgatdldilvnnagvmamgapeevtpemfdrmmavn
akapffivqralsvmpdggriinvssgltrvaspdqvtygmskgaleqialhfsrhlgsr
ritvnsvapgstdngsalfqipevretlsqlstfgevaepaaiadvvaflasedarwitg
afidasggtllg
Timeline for d4kwha_: