Lineage for d1phm__ (1phm -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11958Fold b.13: PNGase F-like [49741] (2 superfamilies)
  4. 11959Superfamily b.13.1: PHM/PNGase F [49742] (2 families) (S)
  5. 11969Family b.13.1.2: Peptidylglycine alpha-hydroxylating monooxygenase, PHM [49746] (1 protein)
  6. 11970Protein Peptidylglycine alpha-hydroxylating monooxygenase, PHM [49747] (1 species)
  7. 11971Species Rat (Rattus norvegicus) [TaxId:10116] [49748] (3 PDB entries)
  8. 11972Domain d1phm__: 1phm - [23659]

Details for d1phm__

PDB Entry: 1phm (more details), 1.9 Å

PDB Description: peptidylglycine alpha-hydroxylating monooxygenase (phm) from rat

SCOP Domain Sequences for d1phm__:

Sequence, based on SEQRES records: (download)

>d1phm__ b.13.1.2 (-) Peptidylglycine alpha-hydroxylating monooxygenase, PHM {Rat (Rattus norvegicus)}
neclgtigpvtpldasdfaldirmpgvtpkesdtyfcmsmrlpvdeeafvidfkprasmd
tvhhmllfgcnmpsstgsywfcdegtctdkanilyawarnapptrlpkgvgfrvggetgs
kyfvlqvhygdisafrdnhkdcsgvsvhltrvpqpliagmylmmsvdtvippgekvvnad
iscqykmypmhvfayrvhthhlgkvvsgyrvrngqwtligrqnpqlpqafypvehpvdvt
fgdilaarcvftgegrteathiggtssdemcnlyimyymeakyalsfmtctknvapdmfr
tipaeanipi

Sequence, based on observed residues (ATOM records): (download)

>d1phm__ b.13.1.2 (-) Peptidylglycine alpha-hydroxylating monooxygenase, PHM {Rat (Rattus norvegicus)}
neclgtigpvtpldasdfaldirmpgvtpkesdtyfcmsmrlpvdeeafvidfkprasmd
tvhhmllfgcnmpsstgsywfcdegtctdkanilyawarnapptrlpkgvgfrvggetgs
kyfvlqvhygdinhkdcsgvsvhltrvpqpliagmylmmsvdtvippgekvvnadiscqy
kmypmhvfayrvhthhlgkvvsgyrvrngqwtligrqnpqlpqafypvehpvdvtfgdil
aarcvftgegrteathiggtssdemcnlyimyymeakyalsfmtctknvapdmfrtipae
anipi

SCOP Domain Coordinates for d1phm__:

Click to download the PDB-style file with coordinates for d1phm__.
(The format of our PDB-style files is described here.)

Timeline for d1phm__:

  • d1phm__ does not appear in SCOP 1.57