| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
| Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
| Protein Malate dehydrogenase [56329] (12 species) |
| Species Thermus thermophilus [TaxId:274] [82806] (7 PDB entries) identical sequence to that from the Thermus flavus enzyme |
| Domain d4kdea2: 4kde A:155-327 [236586] Other proteins in same PDB: d4kdea1, d4kdea3, d4kdeb1, d4kdeb3 automated match to d1wzea2 |
PDB Entry: 4kde (more details), 1.8 Å
SCOPe Domain Sequences for d4kdea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kdea2 d.162.1.1 (A:155-327) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]}
mtrldhnrakaqlakktgtgvdrirrmtvwgnhsstmfpdlfhaevdgrpalelvdmewy
ekvfiptvaqrgaaiiqargassaasaanaaiehirdwalgtpegdwvsmavpsqgeygi
pegivysfpvtakdgayrvvegleinefarkrmeitaqelldemeqvkalgli
Timeline for d4kdea2: