Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins) has C-terminal extension to the common fold |
Protein automated matches [236563] (2 species) not a true protein |
Species Synechocystis sp. [TaxId:1148] [236568] (1 PDB entry) |
Domain d4kt0c_: 4kt0 C: [236582] Other proteins in same PDB: d4kt0a_, d4kt0b_, d4kt0d_, d4kt0e_, d4kt0f_, d4kt0j_ automated match to d1k0ta_ complexed with bcr, cl, cl0, cla, lhg, lmg, lmu, pqn, sf4 |
PDB Entry: 4kt0 (more details), 2.8 Å
SCOPe Domain Sequences for d4kt0c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kt0c_ d.58.1.2 (C:) automated matches {Synechocystis sp. [TaxId: 1148]} shsvkiydtcigctqcvracpldvlemvpwdgckaaqiassprtedcvgckrcetacptd flsirvylgaettrsmglay
Timeline for d4kt0c_: