Lineage for d4kt0c_ (4kt0 C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1906288Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 1906313Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins)
    has C-terminal extension to the common fold
  6. 1906367Protein automated matches [236563] (2 species)
    not a true protein
  7. 1906370Species Synechocystis sp. [TaxId:1148] [236568] (1 PDB entry)
  8. 1906371Domain d4kt0c_: 4kt0 C: [236582]
    Other proteins in same PDB: d4kt0a_, d4kt0b_, d4kt0d_, d4kt0e_, d4kt0f_, d4kt0j_
    automated match to d1k0ta_
    complexed with bcr, cl, cl0, cla, lhg, lmg, lmu, pqn, sf4

Details for d4kt0c_

PDB Entry: 4kt0 (more details), 2.8 Å

PDB Description: Crystal structure of a virus like photosystem I from the cyanobacterium Synechocystis PCC 6803
PDB Compounds: (C:) photosystem I iron-sulfur center

SCOPe Domain Sequences for d4kt0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kt0c_ d.58.1.2 (C:) automated matches {Synechocystis sp. [TaxId: 1148]}
shsvkiydtcigctqcvracpldvlemvpwdgckaaqiassprtedcvgckrcetacptd
flsirvylgaettrsmglay

SCOPe Domain Coordinates for d4kt0c_:

Click to download the PDB-style file with coordinates for d4kt0c_.
(The format of our PDB-style files is described here.)

Timeline for d4kt0c_: