Lineage for d4kt0a_ (4kt0 A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633135Fold f.29: Photosystem I subunits PsaA/PsaB [81559] (1 superfamily)
    core:11 transmembrane helices
  4. 2633136Superfamily f.29.1: Photosystem I subunits PsaA/PsaB [81558] (2 families) (S)
    automatically mapped to Pfam PF00223
  5. 2633137Family f.29.1.1: Photosystem I subunits PsaA/PsaB [81557] (3 proteins)
    Photosystem I p700 chlorophyll a apoprotein a1/a2
  6. 2633148Protein automated matches [236561] (7 species)
    not a true protein
  7. 2633188Species Synechocystis sp. [TaxId:1148] [236567] (1 PDB entry)
  8. 2633189Domain d4kt0a_: 4kt0 A: [236578]
    Other proteins in same PDB: d4kt0c_, d4kt0d_, d4kt0e_, d4kt0f_, d4kt0j_
    automated match to d1jb0a_
    complexed with bcr, cl, cl0, cla, lhg, lmg, lmu, pqn, sf4

Details for d4kt0a_

PDB Entry: 4kt0 (more details), 2.8 Å

PDB Description: Crystal structure of a virus like photosystem I from the cyanobacterium Synechocystis PCC 6803
PDB Compounds: (A:) photosystem I p700 chlorophyll a apoprotein a1

SCOPe Domain Sequences for d4kt0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kt0a_ f.29.1.1 (A:) automated matches {Synechocystis sp. [TaxId: 1148]}
kvsvdnnpvptsfekwgkpghfdrtlargpktttwiwnlhanahdfdsqtsdledvsrki
fsahfghlavvfvwlsgmyfhgakfsnyegwladpthikpsaqvvwpivgqgilngdvgg
gfhgiqitsglfylwrasgftdsyqlyctaigglvmaalmlfagwfhyhvkapklewfqn
vesmmnhhlagllglgslgwaghqihvsmpinklldagvapkdiplphefilepskmael
ypsfaqgltpfftlnwgvysdfltfkgglnpvtgglwlsdtahhhlaiavlfiiaghmyr
tnwgighsmkeileahkgpftgeghkglyeilttswhaqlainlallgsltiivaqhmya
mppypyqaidyatqlslfthhmwiggflivgagahgaifmvrdydpaknvnnlldrmlrh
rdaiishlnwvciflgfhsfglyihndtmralgrpqdmfsdtaiqlqpifaqwvqhlhtl
apgatapnalatasyafggetiavagkvammpitlgtadfmvhhihaftihvtalillkg
vlyarssrlvpdkanlgfrfpcdgpgrggtcqvsgwdhvflglfwmynslsivifhfswk
mqsdvwgtvspdgsvthvtlgnfaqsaitingwlrdflwaqaanvinsygsalsaygimf
laghfvfafslmflfsgrgywqeliesivwahnklnvapaiqpralsiiqgravgvahyl
lggivttwafflarslsig

SCOPe Domain Coordinates for d4kt0a_:

Click to download the PDB-style file with coordinates for d4kt0a_.
(The format of our PDB-style files is described here.)

Timeline for d4kt0a_: