Lineage for d4j16c_ (4j16 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2862578Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2862579Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2862854Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (2 proteins)
    binds NADP, shares with the pyruvate oxidase FAD-binding domain a common ADP-binding mode
    automatically mapped to Pfam PF02233
  6. 2862885Protein automated matches [236540] (2 species)
    not a true protein
  7. 2862888Species Thermus thermophilus [TaxId:262724] [236542] (2 PDB entries)
  8. 2862891Domain d4j16c_: 4j16 C: [236574]
    automated match to d1pnoa_
    complexed with cl, gol, nad, nap, pge

Details for d4j16c_

PDB Entry: 4j16 (more details), 2.41 Å

PDB Description: Crystal structure of Thermus thermophilus transhydrogenase heterotrimeric complex of the Alpha1 subunit dimer with the NADP binding domain (domain III) of the Beta subunit
PDB Compounds: (C:) NAD(P) transhydrogenase subunit beta

SCOPe Domain Sequences for d4j16c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j16c_ c.31.1.4 (C:) automated matches {Thermus thermophilus [TaxId: 262724]}
kgslkpidvedaavmlayagkvvfvpgygmalsqaqhklkeladlleargvevkfaihpv
agrmpghmnvllaeagvdydklkdleeinpefptvdvavvigandvvnpaarrpgsplyg
mpildvdkaknvivikrgqgkgfagvenelfyaentrmlygdaqkvlteliqalkrl

SCOPe Domain Coordinates for d4j16c_:

Click to download the PDB-style file with coordinates for d4j16c_.
(The format of our PDB-style files is described here.)

Timeline for d4j16c_: