SCOPe 2.06: Domain d1pnfa2: 1pnf A:141-314

Lineage for d1pnfa2 (1pnf A:141-314)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.1: PHM/PNGase F [49742] (2 families)
   members of this superfamily bind peptide substrates
   duplication: consists of two domains of this fold packed together like the adjacent nucleoplasmin subunits

5. Family b.121.1.1: Glycosyl-asparaginase [49743] (2 proteins)

6. Protein Peptide:N-glycosidase F, PNGase F [49744] (1 species)

7. Species Flavobacterium meningosepticum [TaxId:238] [49745] (3 PDB entries)

8. Domain d1pnfa2: 1pnf A:141-314 [23656]
   complexed with so4

Details for d1pnfa2

PDB Entry: 1pnf, 2 Å

PDB Description: pngase f complex with di-n-acetylchitobiose

PDB Compounds: (A:) peptide-n(4)-(n-acetyl-beta-d-glucosaminyl)asparagine amidase f

SCOPe Domain Sequences for d1pnfa2:

Sequence; same for both SEQRES and ATOM records:

>d1pnfa2 b.121.1.1 (A:141-314) Peptide:N-glycosidase F, PNGase F {Flavobacterium meningosepticum [TaxId: 238]}
kysavvpviqynkssidgvpygkahtlglkkniqlptntekaylrttisgwghakpydag
srgcaewcfrthtiainnantfqhqlgalgcsanpinnqspgnwapdragwcpgmavptr
idvlnnsltgstfsyeykfqswtnngtngdafyaissfviaksntpisapvvtn

Timeline for d1pnfa2:

• d1pnfa2 first appeared (with stable ids) in SCOP 1.55, called d1pnf_2
  
• d1pnfa2 appears in SCOPe 2.05
  
• d1pnfa2 appears in SCOPe 2.07
  
• d1pnfa2 appears in the current release, SCOPe 2.08