SCOPe 2.03: Domain d4kdea1: 4kde A:1-154

Lineage for d4kdea1 (4kde A:1-154)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Malate dehydrogenase [51849] (13 species)

7. Species Thermus thermophilus [TaxId:274] [82300] (7 PDB entries)
   identical sequence to that from the Thermus flavus enzyme

8. Domain d4kdea1: 4kde A:1-154 [236558]
   Other proteins in same PDB: d4kdea2, d4kdeb2
   automated match to d1iz9a1

Details for d4kdea1

PDB Entry: 4kde, 1.8 Å

PDB Description: Crystal Structure of the Apo Form of Thermus thermophilus Malate Dehydrogenase

PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d4kdea1:

Sequence; same for both SEQRES and ATOM records:

>d4kdea1 c.2.1.5 (A:1-154) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]}
mkapvrvavtgaagqigysllfriaagemlgkdqpvilqlleipqamkalegvvmeledc
afpllagleatddpkvafkdadyallvgaaprkagmerrdllqvngkifteqgralaeva
kkdvkvlvvgnpantnaliayknapglnprnfta

Timeline for d4kdea1:

• d4kdea1 is new in SCOPe 2.03-stable
  
• d4kdea1 appears in SCOPe 2.04
  
• d4kdea1 appears in the current release, SCOPe 2.08