| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
| Protein Malate dehydrogenase [51849] (13 species) |
| Species Thermus thermophilus [TaxId:274] [82300] (7 PDB entries) identical sequence to that from the Thermus flavus enzyme |
| Domain d4kdea1: 4kde A:1-154 [236558] Other proteins in same PDB: d4kdea2, d4kdea3, d4kdeb2, d4kdeb3 automated match to d1iz9a1 |
PDB Entry: 4kde (more details), 1.8 Å
SCOPe Domain Sequences for d4kdea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kdea1 c.2.1.5 (A:1-154) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]}
mkapvrvavtgaagqigysllfriaagemlgkdqpvilqlleipqamkalegvvmeledc
afpllagleatddpkvafkdadyallvgaaprkagmerrdllqvngkifteqgralaeva
kkdvkvlvvgnpantnaliayknapglnprnfta
Timeline for d4kdea1: