Lineage for d4kdea1 (4kde A:1-154)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844315Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2844748Protein Malate dehydrogenase [51849] (13 species)
  7. 2844835Species Thermus thermophilus [TaxId:274] [82300] (7 PDB entries)
    identical sequence to that from the Thermus flavus enzyme
  8. 2844838Domain d4kdea1: 4kde A:1-154 [236558]
    Other proteins in same PDB: d4kdea2, d4kdea3, d4kdeb2, d4kdeb3
    automated match to d1iz9a1

Details for d4kdea1

PDB Entry: 4kde (more details), 1.8 Å

PDB Description: Crystal Structure of the Apo Form of Thermus thermophilus Malate Dehydrogenase
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d4kdea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kdea1 c.2.1.5 (A:1-154) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]}
mkapvrvavtgaagqigysllfriaagemlgkdqpvilqlleipqamkalegvvmeledc
afpllagleatddpkvafkdadyallvgaaprkagmerrdllqvngkifteqgralaeva
kkdvkvlvvgnpantnaliayknapglnprnfta

SCOPe Domain Coordinates for d4kdea1:

Click to download the PDB-style file with coordinates for d4kdea1.
(The format of our PDB-style files is described here.)

Timeline for d4kdea1: