Lineage for d4kdfd1 (4kdf D:1-154)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1829377Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 1829635Protein Malate dehydrogenase [51849] (13 species)
  7. 1829718Species Thermus thermophilus [TaxId:274] [82300] (7 PDB entries)
    identical sequence to that from the Thermus flavus enzyme
  8. 1829734Domain d4kdfd1: 4kdf D:1-154 [236554]
    Other proteins in same PDB: d4kdfa2, d4kdfd2
    automated match to d1iz9a1
    complexed with so4

Details for d4kdfd1

PDB Entry: 4kdf (more details), 2.36 Å

PDB Description: Crystal Structure of Thermus thermophilus Malate Dehydrogenase in Complex with NAD
PDB Compounds: (D:) malate dehydrogenase

SCOPe Domain Sequences for d4kdfd1:

Sequence, based on SEQRES records: (download)

>d4kdfd1 c.2.1.5 (D:1-154) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]}
mkapvrvavtgaagqigysllfriaagemlgkdqpvilqlleipqamkalegvvmeledc
afpllagleatddpkvafkdadyallvgaaprkagmerrdllqvngkifteqgralaeva
kkdvkvlvvgnpantnaliayknapglnprnfta

Sequence, based on observed residues (ATOM records): (download)

>d4kdfd1 c.2.1.5 (D:1-154) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]}
mkapvrvavtgaagqigysllfriaagemlgkdqpvilqlleipqamkalegvvmeledc
afpllagleatddpkvafkdadyallvgaaprllqvngkifteqgralaevakkdvkvlv
vgnpantnaliayknapglnprnfta

SCOPe Domain Coordinates for d4kdfd1:

Click to download the PDB-style file with coordinates for d4kdfd1.
(The format of our PDB-style files is described here.)

Timeline for d4kdfd1: