SCOPe 2.08: Domain d4j1tf_: 4j1t F:

Lineage for d4j1tf_ (4j1t F:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (2 proteins)
   binds NADP, shares with the pyruvate oxidase FAD-binding domain a common ADP-binding mode
   automatically mapped to Pfam PF02233

6. Protein automated matches [236540] (2 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:262724] [236542] (2 PDB entries)

8. Domain d4j1tf_: 4j1t F: [236543]
   automated match to d1pnoa_
   complexed with gol, nad, nap

Details for d4j1tf_

PDB Entry: 4j1t, 2.37 Å

PDB Description: Crystal structure of Thermus thermophilus transhydrogenase heterotrimeric complex of the Alpha1 subunit dimer with the NADP binding domain (domain III) of the Beta subunit in P2(1)

PDB Compounds: (F:) NAD(P) transhydrogenase subunit beta

SCOPe Domain Sequences for d4j1tf_:

Sequence; same for both SEQRES and ATOM records:

>d4j1tf_ c.31.1.4 (F:) automated matches {Thermus thermophilus [TaxId: 262724]}
kgslkpidvedaavmlayagkvvfvpgygmalsqaqhklkeladlleargvevkfaihpv
agrmpghmnvllaeagvdydklkdleeinpefptvdvavvigandvvnpaarrpgsplyg
mpildvdkaknvivikrgqgkgfagvenelfyaentrmlygdaqkvlteliqalkrl

Timeline for d4j1tf_:

• d4j1tf_ first appeared in SCOPe 2.03
  
• d4j1tf_ appears in SCOPe 2.07