Class b: All beta proteins [48724] (176 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.1: PHM/PNGase F [49742] (2 families) members of this superfamily bind peptide substrates duplication: consists of two domains of this fold packed together like the adjacent nucleoplasmin subunits |
Family b.121.1.1: Glycosyl-asparaginase [49743] (2 proteins) |
Protein Peptide:N-glycosidase F, PNGase F [49744] (1 species) |
Species Flavobacterium meningosepticum [TaxId:238] [49745] (3 PDB entries) |
Domain d1pgsa2: 1pgs A:141-314 [23654] |
PDB Entry: 1pgs (more details), 1.8 Å
SCOPe Domain Sequences for d1pgsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pgsa2 b.121.1.1 (A:141-314) Peptide:N-glycosidase F, PNGase F {Flavobacterium meningosepticum [TaxId: 238]} kysavvpviqynkssidgvpygkahtlglkkniqlptntekaylrttisgwghakpydag srgcaewcfrthtiainnantfqhqlgalgcsanpinnqspgnwtpdragwcpgmavptr idvlnnsltgstfsyeykfqswtnngtngdafyaissfviaksntpisapvvtn
Timeline for d1pgsa2: