Lineage for d1pgs_2 (1pgs 141-314)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 57065Fold b.13: PNGase F-like [49741] (2 superfamilies)
  4. 57066Superfamily b.13.1: PHM/PNGase F [49742] (2 families) (S)
  5. 57067Family b.13.1.1: Glycosyl-asparaginase [49743] (1 protein)
  6. 57068Protein Peptide:N-glycosidase F, PNGase F [49744] (1 species)
  7. 57069Species Flavobacterium meningosepticum [TaxId:238] [49745] (3 PDB entries)
  8. 57071Domain d1pgs_2: 1pgs 141-314 [23654]

Details for d1pgs_2

PDB Entry: 1pgs (more details), 1.8 Å

PDB Description: the three-dimensional structure of pngase f, a glycosylasparaginase from flavobacterium meningosepticum

SCOP Domain Sequences for d1pgs_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pgs_2 b.13.1.1 (141-314) Peptide:N-glycosidase F, PNGase F {Flavobacterium meningosepticum}
kysavvpviqynkssidgvpygkahtlglkkniqlptntekaylrttisgwghakpydag
srgcaewcfrthtiainnantfqhqlgalgcsanpinnqspgnwtpdragwcpgmavptr
idvlnnsltgstfsyeykfqswtnngtngdafyaissfviaksntpisapvvtn

SCOP Domain Coordinates for d1pgs_2:

Click to download the PDB-style file with coordinates for d1pgs_2.
(The format of our PDB-style files is described here.)

Timeline for d1pgs_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pgs_1