Lineage for d4i07a_ (4i07 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927640Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2927641Protein automated matches [190230] (23 species)
    not a true protein
  7. 2927642Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [189710] (7 PDB entries)
  8. 2927645Domain d4i07a_: 4i07 A: [236539]
    automated match to d3s3qa_
    complexed with act, cl

Details for d4i07a_

PDB Entry: 4i07 (more details), 1.3 Å

PDB Description: structure of mature form of cathepsin b1 from schistosoma mansoni
PDB Compounds: (A:) Cathepsin B-like peptidase (C01 family)

SCOPe Domain Sequences for d4i07a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i07a_ d.3.1.0 (A:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
eipssfdsrkkwprcksiatirdqsrcgscwafgaveamsdrsciqsggkqnvelsavdl
lsccescglgceggilgpawdywvkegivtgsskenhagcepypfpkcehhtkgkyppcg
skiyktprckqtcqkkyktpytqdkhrgkssynvkndekaiqkeimkygpveagftvyed
flnyksgiykhitgetlgghairiigwgvenkapywlianswnedwgengyfrivrgrde
csiesevtagrin

SCOPe Domain Coordinates for d4i07a_:

Click to download the PDB-style file with coordinates for d4i07a_.
(The format of our PDB-style files is described here.)

Timeline for d4i07a_: