| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
| Family d.3.1.0: automated matches [191342] (1 protein) not a true family |
| Protein automated matches [190230] (23 species) not a true protein |
| Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [189710] (7 PDB entries) |
| Domain d4i07a_: 4i07 A: [236539] automated match to d3s3qa_ complexed with act, cl |
PDB Entry: 4i07 (more details), 1.3 Å
SCOPe Domain Sequences for d4i07a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i07a_ d.3.1.0 (A:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
eipssfdsrkkwprcksiatirdqsrcgscwafgaveamsdrsciqsggkqnvelsavdl
lsccescglgceggilgpawdywvkegivtgsskenhagcepypfpkcehhtkgkyppcg
skiyktprckqtcqkkyktpytqdkhrgkssynvkndekaiqkeimkygpveagftvyed
flnyksgiykhitgetlgghairiigwgvenkapywlianswnedwgengyfrivrgrde
csiesevtagrin
Timeline for d4i07a_: