SCOPe 2.07: Domain d4cl3d2: 4cl3 D:144-309

Lineage for d4cl3d2 (4cl3 D:144-309)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein Malate dehydrogenase [56329] (12 species)

7. Species Chloroflexus sp. [TaxId:480224] [236535] (1 PDB entry)

8. Domain d4cl3d2: 4cl3 D:144-309 [236538]
   Other proteins in same PDB: d4cl3a1, d4cl3d1
   automated match to d1guya2
   complexed with act, cd, cl, peg

Details for d4cl3d2

PDB Entry: 4cl3, 1.7 Å

PDB Description: 1.70 a resolution structure of the malate dehydrogenase from chloroflexus aurantiacus

PDB Compounds: (D:) malate dehydrogenase

SCOPe Domain Sequences for d4cl3d2:

Sequence; same for both SEQRES and ATOM records:

>d4cl3d2 d.162.1.1 (D:144-309) Malate dehydrogenase {Chloroflexus sp. [TaxId: 480224]}
agvldaaryrtfiameagvsvedvqamlmgghgdemvplprfstisgipvsefiapdrla
qivertrkgggeivnllktgsayyapaaataqmveavlkdkkrvmpvaayltgqyglndi
yfgvpvilgaggvekilelplneeemallnasakavratldtlksl

Timeline for d4cl3d2:

• d4cl3d2 first appeared in SCOPe 2.03
  
• d4cl3d2 appears in SCOPe 2.06
  
• d4cl3d2 appears in the current release, SCOPe 2.08