Lineage for d4cl3a2 (4cl3 A:144-309)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1680346Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1680347Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1680348Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1680540Protein Malate dehydrogenase [56329] (12 species)
  7. 1680572Species Chloroflexus sp. [TaxId:480224] [236535] (1 PDB entry)
  8. 1680573Domain d4cl3a2: 4cl3 A:144-309 [236537]
    Other proteins in same PDB: d4cl3a1, d4cl3d1
    automated match to d1guya2
    complexed with act, cd, cl, peg

Details for d4cl3a2

PDB Entry: 4cl3 (more details), 1.7 Å

PDB Description: 1.70 a resolution structure of the malate dehydrogenase from chloroflexus aurantiacus
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d4cl3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cl3a2 d.162.1.1 (A:144-309) Malate dehydrogenase {Chloroflexus sp. [TaxId: 480224]}
agvldaaryrtfiameagvsvedvqamlmgghgdemvplprfstisgipvsefiapdrla
qivertrkgggeivnllktgsayyapaaataqmveavlkdkkrvmpvaayltgqyglndi
yfgvpvilgaggvekilelplneeemallnasakavratldtlksl

SCOPe Domain Coordinates for d4cl3a2:

Click to download the PDB-style file with coordinates for d4cl3a2.
(The format of our PDB-style files is described here.)

Timeline for d4cl3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4cl3a1