SCOPe 2.05: Domain d4g7vl2: 4g7v L:108-211

Lineage for d4g7vl2 (4g7v L:108-211)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)

8. Domain d4g7vl2: 4g7v L:108-211 [236534]
   Other proteins in same PDB: d4g7vl1
   automated match to d1ce1l2
   complexed with cl, lda, sin

Details for d4g7vl2

PDB Entry: 4g7v, 2.5 Å

PDB Description: crystal structure of voltage sensing domain of ci-vsp with fragment antibody (r217e, 2.5 a)

PDB Compounds: (L:) fragment antibody light chain

SCOPe Domain Sequences for d4g7vl2:

Sequence; same for both SEQRES and ATOM records:

>d4g7vl2 b.1.1.2 (L:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqagnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d4g7vl2:

• d4g7vl2 first appeared in SCOPe 2.03
  
• d4g7vl2 appears in SCOPe 2.04
  
• d4g7vl2 appears in SCOPe 2.06
  
• d4g7vl2 appears in the current release, SCOPe 2.08