Lineage for d1pgs_1 (1pgs 4-140)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.13: PNGase F-like [49741] (2 superfamilies) 
Superfamily b.13.1: PHM/PNGase F [49742] (2 families) 
Family b.13.1.1: Glycosyl-asparaginase [49743] (1 protein) Protein Peptide:N-glycosidase F, PNGase F [49744] (1 species) Species Flavobacterium meningosepticum [TaxId:238] [49745] (3 PDB entries) 
Domain d1pgs_1: 1pgs 4-140 [23653]
Details for d1pgs_1
PDB Entry: 1pgs (more details), 1.8 Å
PDB Description: the three-dimensional structure of pngase f, a glycosylasparaginase from flavobacterium meningosepticum
SCOP Domain Sequences for d1pgs_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pgs_1 b.13.1.1 (4-140) Peptide:N-glycosidase F, PNGase F {Flavobacterium meningosepticum}
dntvniktfdkvknafgdglsqsaegtftfpadvttvktikmfiknecpnktcdewdrya
nvyvknkttgewyeigrfitpywvgteklprgleidvtdfksllsgntelkiytetwlak
greysvdfdivygtpdy
SCOP Domain Coordinates for d1pgs_1:
Click to download the PDB-style file with coordinates for d1pgs_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pgs_1:
- d1pgs_1 appears in SCOP 1.57
- d1pgs_1 appears in the current release, SCOPe 2.08, called d1pgsa1
View in 3D
