Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
Protein Malate dehydrogenase [51849] (13 species) |
Species Chloroflexus sp. [TaxId:480224] [236527] (1 PDB entry) |
Domain d4cl3d1: 4cl3 D:1-143 [236529] Other proteins in same PDB: d4cl3a2, d4cl3d2 automated match to d1guya1 complexed with act, cd, cl, peg |
PDB Entry: 4cl3 (more details), 1.7 Å
SCOPe Domain Sequences for d4cl3d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cl3d1 c.2.1.5 (D:1-143) Malate dehydrogenase {Chloroflexus sp. [TaxId: 480224]} mrkkisiigagfvgsttahwlaakelgdivlldivegvpqgkaldlyeaspiegfdvrvt gtnnyadtansdvivvtsgaprkpgmsredlikvnaditracisqaaplspnaviimvnn pldamtylaaevsgfpkervigq
Timeline for d4cl3d1: