Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.0: automated matches [191411] (1 protein) not a true family |
Protein automated matches [190563] (9 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [236519] (1 PDB entry) |
Domain d4cgee_: 4cge E: [236525] automated match to d1xsfa1 |
PDB Entry: 4cge (more details), 2.76 Å
SCOPe Domain Sequences for d4cgee_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cgee_ d.2.1.0 (E:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} nwdaiaqcesggnwsintgngyygglrftagtwranggsgsaanasreeqirvaenvlrs qgirawpvcgr
Timeline for d4cgee_: