SCOPe 2.03: Domain d4cgee_: 4cge E:

Lineage for d4cgee_ (4cge E:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.0: automated matches [191411] (1 protein)
   not a true family

6. Protein automated matches [190563] (9 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [236519] (1 PDB entry)

8. Domain d4cgee_: 4cge E: [236525]
   automated match to d1xsfa1

Details for d4cgee_

PDB Entry: 4cge, 2.76 Å

PDB Description: Crystal structure of Mycobacterium tuberculosis Resuscitation promoting factor E

PDB Compounds: (E:) resuscitation-promoting factor rpfe

SCOPe Domain Sequences for d4cgee_:

Sequence; same for both SEQRES and ATOM records:

>d4cgee_ d.2.1.0 (E:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
nwdaiaqcesggnwsintgngyygglrftagtwranggsgsaanasreeqirvaenvlrs
qgirawpvcgr

Timeline for d4cgee_:

• d4cgee_ is new in SCOPe 2.03-stable
  
• d4cgee_ appears in SCOPe 2.04
  
• d4cgee_ appears in the current release, SCOPe 2.08