Lineage for d1qm6b2 (1qm6 B:250-370)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11920Fold b.12: Lipase/lipooxygenase domain [49722] (1 superfamily)
  4. 11921Superfamily b.12.1: Lipase/lipooxygenase domain [49723] (3 families) (S)
  5. 11950Family b.12.1.3: Alpha-toxin, C-terminal domain [49738] (1 protein)
  6. 11951Protein Alpha-toxin, C-terminal domain [49739] (1 species)
  7. 11952Species Clostridium perfringens [TaxId:1502] [49740] (3 PDB entries)
  8. 11957Domain d1qm6b2: 1qm6 B:250-370 [23652]
    Other proteins in same PDB: d1qm6a1, d1qm6b1

Details for d1qm6b2

PDB Entry: 1qm6 (more details), 2.5 Å

PDB Description: r32 form of clostridium perfringens alpha-toxin strain

SCOP Domain Sequences for d1qm6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qm6b2 b.12.1.3 (B:250-370) Alpha-toxin, C-terminal domain {Clostridium perfringens}
svgknvkelvayistsgekdagtddymyfgiktkdgktqewemdnpgndfmtgskdtytf
klkdenlkiddiqnmwirkrkytafsdaykpenikiiangkvvvdkdinewisgnstyni
k

SCOP Domain Coordinates for d1qm6b2:

Click to download the PDB-style file with coordinates for d1qm6b2.
(The format of our PDB-style files is described here.)

Timeline for d1qm6b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qm6b1