SCOPe 2.08: Domain d1qm6b2: 1qm6 B:250-370

Lineage for d1qm6b2 (1qm6 B:250-370)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology
   duplication: has weak internal pseudo twofold symmetry

4. Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families)

5. Family b.12.1.3: Alpha-toxin, C-terminal domain [49738] (1 protein)
   automatically mapped to Pfam PF01477

6. Protein Alpha-toxin, C-terminal domain [49739] (2 species)

7. Species Clostridium perfringens, different strains [TaxId:1502] [49740] (6 PDB entries)

8. Domain d1qm6b2: 1qm6 B:250-370 [23652]
   Other proteins in same PDB: d1qm6a1, d1qm6b1
   complexed with zn

Details for d1qm6b2

PDB Entry: 1qm6, 2.5 Å

PDB Description: closed form of clostridium perfringens alpha-toxin strain nctc8237

PDB Compounds: (B:) phospholipase c

SCOPe Domain Sequences for d1qm6b2:

Sequence; same for both SEQRES and ATOM records:

>d1qm6b2 b.12.1.3 (B:250-370) Alpha-toxin, C-terminal domain {Clostridium perfringens, different strains [TaxId: 1502]}
svgknvkelvayistsgekdagtddymyfgiktkdgktqewemdnpgndfmtgskdtytf
klkdenlkiddiqnmwirkrkytafsdaykpenikiiangkvvvdkdinewisgnstyni
k

Timeline for d1qm6b2:

• d1qm6b2 first appeared (with stable ids) in SCOP 1.55
  
• d1qm6b2 appears in SCOPe 2.07