Lineage for d4c74a1 (4c74 A:12-154,A:390-542)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849878Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2850147Protein Phenylacetone monooxygenase [110440] (1 species)
  7. 2850148Species Thermobifida fusca [TaxId:2021] [110441] (6 PDB entries)
    Uniprot Q5YS95 # 55% sequence identity; Nocardia farcinica TaxID:37329
  8. 2850153Domain d4c74a1: 4c74 A:12-154,A:390-542 [236517]
    automated match to d1w4xa1
    complexed with fad, n01, p6g

    has additional insertions and/or extensions that are not grouped together

Details for d4c74a1

PDB Entry: 4c74 (more details), 1.97 Å

PDB Description: Phenylacetone monooxygenase: Reduced enzyme in complex with APADP
PDB Compounds: (A:) phenylacetone monooxygenase

SCOPe Domain Sequences for d4c74a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c74a1 c.3.1.5 (A:12-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]}
qppeevdvlvvgagfsglyalyrlrelgrsvhvietagdvggvwywnrypgarcdiesie
ycysfseevlqewnwteryasqpeilryinfvadkfdlrsgitfhttvtaaafdeatntw
tvdtnhgdrirarylimasgqlsXdaltgalfkidirgvgnvalkekwaagprtylglst
agfpnlffiagpgspsalsnmlvsieqhvewvtdhiaymfkngltrseavlekedewveh
vneiadetlypmtaswytganvpgkprvfmlyvggfhryrqicdevaakgyegfvlt

SCOPe Domain Coordinates for d4c74a1:

Click to download the PDB-style file with coordinates for d4c74a1.
(The format of our PDB-style files is described here.)

Timeline for d4c74a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4c74a2