SCOPe 2.03: Domain d4c52b_: 4c52 B:

Lineage for d4c52b_ (4c52 B:)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein automated matches [190236] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188722] (29 PDB entries)

8. Domain d4c52b_: 4c52 B: [236514]
   automated match to d3fdma_
   complexed with edo, so4, x0d

Details for d4c52b_

PDB Entry: 4c52, 2.05 Å

PDB Description: crystal structure of bcl-xl in complex with benzoylurea compound (39b)

PDB Compounds: (B:) Bcl-2-like protein 1

SCOPe Domain Sequences for d4c52b_:

Sequence; same for both SEQRES and ATOM records:

>d4c52b_ f.1.4.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lgsmsqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlh
itpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmaty
lndhlepwiqenggwdtfvelygnn

Timeline for d4c52b_:

• d4c52b_ is new in SCOPe 2.03-stable
  
• d4c52b_ appears in SCOPe 2.04
  
• d4c52b_ appears in the current release, SCOPe 2.08, called d4c52b1