Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins) Pfam PF00452 |
Protein automated matches [190236] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188722] (26 PDB entries) |
Domain d4c52a1: 4c52 A:1-196 [236513] Other proteins in same PDB: d4c52a2, d4c52b2 automated match to d3fdma_ complexed with edo, so4, x0d |
PDB Entry: 4c52 (more details), 2.05 Å
SCOPe Domain Sequences for d4c52a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c52a1 f.1.4.1 (A:1-196) automated matches {Human (Homo sapiens) [TaxId: 9606]} msqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitp gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd hlepwiqenggwdtfvelyg
Timeline for d4c52a1: