Lineage for d4c52a1 (4c52 A:1-196)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021035Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 3021129Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 3021130Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 3021485Protein automated matches [190236] (3 species)
    not a true protein
  7. 3021486Species Human (Homo sapiens) [TaxId:9606] [188722] (26 PDB entries)
  8. 3021513Domain d4c52a1: 4c52 A:1-196 [236513]
    Other proteins in same PDB: d4c52a2, d4c52b2
    automated match to d3fdma_
    complexed with edo, so4, x0d

Details for d4c52a1

PDB Entry: 4c52 (more details), 2.05 Å

PDB Description: crystal structure of bcl-xl in complex with benzoylurea compound (39b)
PDB Compounds: (A:) Bcl-2-like protein 1

SCOPe Domain Sequences for d4c52a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c52a1 f.1.4.1 (A:1-196) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitp
gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd
hlepwiqenggwdtfvelyg

SCOPe Domain Coordinates for d4c52a1:

Click to download the PDB-style file with coordinates for d4c52a1.
(The format of our PDB-style files is described here.)

Timeline for d4c52a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4c52a2