SCOPe 2.07: Domain d3zo5b1: 3zo5 B:16-95

Lineage for d3zo5b1 (3zo5 B:16-95)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein automated matches [190118] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189560] (114 PDB entries)

8. Domain d3zo5b1: 3zo5 B:16-95 [236508]
   Other proteins in same PDB: d3zo5a_, d3zo5b2
   automated match to d2ckhb1

Details for d3zo5b1

PDB Entry: 3zo5, 2.15 Å

PDB Description: Structure of SENP2-Loop1 in complex with preSUMO-2

PDB Compounds: (B:) Small ubiquitin-related modifier 2

SCOPe Domain Sequences for d3zo5b1:

Sequence; same for both SEQRES and ATOM records:

>d3zo5b1 d.15.1.1 (B:16-95) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpaq
lemededtidvfqqqtggvy

Timeline for d3zo5b1:

• d3zo5b1 first appeared in SCOPe 2.03, called d3zo5b_
  
• d3zo5b1 appears in SCOPe 2.06
  
• d3zo5b1 appears in the current release, SCOPe 2.08