Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.13: SpoIIaa-like [52086] (2 superfamilies) core: 4 turns of a (beta-alpha)n superhelix |
Superfamily c.13.1: CRAL/TRIO domain [52087] (2 families) automatically mapped to Pfam PF00650 |
Family c.13.1.1: CRAL/TRIO domain [52088] (4 proteins) Pfam PF00650 |
Protein automated matches [233926] (1 species) not a true protein |
Species Mus musculus [TaxId:10090] [233927] (2 PDB entries) |
Domain d3w68a2: 3w68 A:91-275 [236500] Other proteins in same PDB: d3w68a1, d3w68b1, d3w68c1, d3w68d1 automated match to d3w67a2 complexed with 4pt, pbu, po4, viv |
PDB Entry: 3w68 (more details), 2.05 Å
SCOPe Domain Sequences for d3w68a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3w68a2 c.13.1.1 (A:91-275) automated matches {Mus musculus [TaxId: 10090]} silgllkagyhgvlrsrdstgsrvliyriaywdpkvftaydvfrvslitselivqevetq rngvkaifdlegwqvshafqitpsvakkiaavltdsfplkvrgihlinepvifhavfsmi kpfltekikdrihlhgnnykssmlqhfpdilpreyggkefsmedicqewtnfimksedyl ssise
Timeline for d3w68a2: