Lineage for d3w59d_ (3w59 D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779190Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 2779208Protein Galectin-1 [100925] (5 species)
  7. 2779225Species Human (Homo sapiens) [TaxId:9606] [101638] (33 PDB entries)
    Uniprot P09382
  8. 2779275Domain d3w59d_: 3w59 D: [236498]
    automated match to d1gzwa_
    complexed with bme, gol, so4

Details for d3w59d_

PDB Entry: 3w59 (more details), 2.1 Å

PDB Description: Crystal structure of Galectin-1 in the lactose-unbound state(P212121)
PDB Compounds: (D:) galectin-1

SCOPe Domain Sequences for d3w59d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w59d_ b.29.1.3 (D:) Galectin-1 {Human (Homo sapiens) [TaxId: 9606]}
cglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivcn
skdggawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainyma
adgdfkikcvafd

SCOPe Domain Coordinates for d3w59d_:

Click to download the PDB-style file with coordinates for d3w59d_.
(The format of our PDB-style files is described here.)

Timeline for d3w59d_: