![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.13: SpoIIaa-like [52086] (2 superfamilies) core: 4 turns of a (beta-alpha)n superhelix |
![]() | Superfamily c.13.1: CRAL/TRIO domain [52087] (2 families) ![]() automatically mapped to Pfam PF00650 |
![]() | Family c.13.1.1: CRAL/TRIO domain [52088] (4 proteins) Pfam PF00650 |
![]() | Protein automated matches [233926] (3 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [233927] (2 PDB entries) |
![]() | Domain d3w68c2: 3w68 C:91-277 [236493] Other proteins in same PDB: d3w68a1, d3w68b1, d3w68c1, d3w68d1 automated match to d3w67a2 complexed with 4pt, pbu, po4, viv |
PDB Entry: 3w68 (more details), 2.05 Å
SCOPe Domain Sequences for d3w68c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3w68c2 c.13.1.1 (C:91-277) automated matches {Mouse (Mus musculus) [TaxId: 10090]} silgllkagyhgvlrsrdstgsrvliyriaywdpkvftaydvfrvslitselivqevetq rngvkaifdlegwqvshafqitpsvakkiaavltdsfplkvrgihlinepvifhavfsmi kpfltekikdrihlhgnnykssmlqhfpdilpreyggkefsmedicqewtnfimksedyl ssiseti
Timeline for d3w68c2: