Lineage for d3w68c1 (3w68 C:26-90)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696009Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2696232Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (2 families) (S)
  5. 2696251Family a.5.3.0: automated matches [227224] (1 protein)
    not a true family
  6. 2696252Protein automated matches [226965] (4 species)
    not a true protein
  7. 2696271Species Mouse (Mus musculus) [TaxId:10090] [233924] (2 PDB entries)
  8. 2696274Domain d3w68c1: 3w68 C:26-90 [236492]
    Other proteins in same PDB: d3w68a2, d3w68b2, d3w68c2, d3w68d2
    automated match to d3w67a1
    complexed with 4pt, pbu, po4, viv

Details for d3w68c1

PDB Entry: 3w68 (more details), 2.05 Å

PDB Description: Crystal structure of mouse alpha-tocopherol transfer protein in complex with alpha-tocopherol and phosphatidylinositol-(4,5)-bisphosphate
PDB Compounds: (C:) alpha-tocopherol transfer protein

SCOPe Domain Sequences for d3w68c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w68c1 a.5.3.0 (C:26-90) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pglaelrrrvqeagvpqtpqpltdafllrflrardfdldlawrlmknyykwraecpelsa
dlrpr

SCOPe Domain Coordinates for d3w68c1:

Click to download the PDB-style file with coordinates for d3w68c1.
(The format of our PDB-style files is described here.)

Timeline for d3w68c1: