![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
![]() | Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (2 families) ![]() |
![]() | Family a.5.3.0: automated matches [227224] (1 protein) not a true family |
![]() | Protein automated matches [226965] (4 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [233924] (2 PDB entries) |
![]() | Domain d3w68c1: 3w68 C:26-90 [236492] Other proteins in same PDB: d3w68a2, d3w68b2, d3w68c2, d3w68d2 automated match to d3w67a1 complexed with 4pt, pbu, po4, viv |
PDB Entry: 3w68 (more details), 2.05 Å
SCOPe Domain Sequences for d3w68c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3w68c1 a.5.3.0 (C:26-90) automated matches {Mouse (Mus musculus) [TaxId: 10090]} pglaelrrrvqeagvpqtpqpltdafllrflrardfdldlawrlmknyykwraecpelsa dlrpr
Timeline for d3w68c1: