Lineage for d1qmda2 (1qmd A:250-370)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 57022Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
  4. 57023Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (3 families) (S)
  5. 57057Family b.12.1.3: Alpha-toxin, C-terminal domain [49738] (1 protein)
  6. 57058Protein Alpha-toxin, C-terminal domain [49739] (1 species)
  7. 57059Species Clostridium perfringens [TaxId:1502] [49740] (3 PDB entries)
  8. 57061Domain d1qmda2: 1qmd A:250-370 [23649]
    Other proteins in same PDB: d1qmda1, d1qmdb1

Details for d1qmda2

PDB Entry: 1qmd (more details), 2.2 Å

PDB Description: calcium bound closed form alpha-toxin from clostridium perfringens

SCOP Domain Sequences for d1qmda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qmda2 b.12.1.3 (A:250-370) Alpha-toxin, C-terminal domain {Clostridium perfringens}
svgknvkelvayistsgekdagtddymyfgiktkdgktqewemdnpgndfmtgskdtytf
klkdenlkiddiqnmwirkrkytafsdaykpenikiiangkvvvdkdinewisgnstyni
k

SCOP Domain Coordinates for d1qmda2:

Click to download the PDB-style file with coordinates for d1qmda2.
(The format of our PDB-style files is described here.)

Timeline for d1qmda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qmda1