![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
![]() | Protein automated matches [190246] (71 species) not a true protein |
![]() | Species Novosphingobium aromaticivorans [TaxId:279238] [226680] (3 PDB entries) |
![]() | Domain d4og1a_: 4og1 A: [236487] automated match to d1dcia_ complexed with pe8 |
PDB Entry: 4og1 (more details), 2.05 Å
SCOPe Domain Sequences for d4og1a_:
Sequence, based on SEQRES records: (download)
>d4og1a_ c.14.1.0 (A:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]} mpnmnfhdrvsvtiedhvahvlldradkmnalddamfegivaaghhlhsvkgvrcvvlsg agrsfcagldlssmgrtdrwsgnslterthgnanraqqaamvwrklpmpviaavhgvcfg gglqvasgadirfitpdarlavmevkwglvpdmagyalwrgnvrddvlreltythrefsg eeavrfgfathvaddplagamelarvvaekspnavrgaktlsnrapdltvddvlmaesia qhelmysrnqmeavkagmekragdfvdp
>d4og1a_ c.14.1.0 (A:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]} mpnmnfhdrvsvtiedhvahvlldradkmnalddamfegivaaghhlhsvkgvrcvvlsg agrsfcagldlsslterthgnanraqqaamvwrklpmpviaavhgvcfggglqvasgadi rfitpdarlavmevkwglvpdmagyalwrgnvrddvlreltythrefsgeeavrfgfath vaddplagamelarvvaekspnavrgaktlsnrapdltvddvlmaesiaqhelmysrnqm eavkagmekragdfvdp
Timeline for d4og1a_: