Lineage for d1ca1_2 (1ca1 250-370)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11920Fold b.12: Lipase/lipooxygenase domain [49722] (1 superfamily)
  4. 11921Superfamily b.12.1: Lipase/lipooxygenase domain [49723] (3 families) (S)
  5. 11950Family b.12.1.3: Alpha-toxin, C-terminal domain [49738] (1 protein)
  6. 11951Protein Alpha-toxin, C-terminal domain [49739] (1 species)
  7. 11952Species Clostridium perfringens [TaxId:1502] [49740] (3 PDB entries)
  8. 11953Domain d1ca1_2: 1ca1 250-370 [23648]
    Other proteins in same PDB: d1ca1_1

Details for d1ca1_2

PDB Entry: 1ca1 (more details), 1.9 Å

PDB Description: alpha-toxin from clostridium perfringens

SCOP Domain Sequences for d1ca1_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ca1_2 b.12.1.3 (250-370) Alpha-toxin, C-terminal domain {Clostridium perfringens}
svgknvkelvayistsgekdagtddymyfgiktkdgktqewemdnpgndfmtgskdtytf
klkdenlkiddiqnmwirkrkytafpdaykpenikviangkvvvdkdinewisgnstyni
k

SCOP Domain Coordinates for d1ca1_2:

Click to download the PDB-style file with coordinates for d1ca1_2.
(The format of our PDB-style files is described here.)

Timeline for d1ca1_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ca1_1