| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) ![]() |
| Family a.29.2.1: Bromodomain [47371] (6 proteins) |
| Protein automated matches [190366] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187201] (46 PDB entries) |
| Domain d4nyvd_: 4nyv D: [236479] automated match to d3p1ea_ complexed with 15e |
PDB Entry: 4nyv (more details), 1.83 Å
SCOPe Domain Sequences for d4nyvd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nyvd_ a.29.2.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkl
dtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl
Timeline for d4nyvd_: