SCOPe 2.08: Domain d4neec1: 4nee C:72-203

Lineage for d4neec1 (4nee C:72-203)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.102: Regulatory factor Nef [55670] (1 superfamily)
   alpha(2)-beta(4)-alpha; 3 layers: alpha/beta/alpha

4. Superfamily d.102.1: Regulatory factor Nef [55671] (2 families)

5. Family d.102.1.0: automated matches [191617] (1 protein)
   not a true family

6. Protein automated matches [191127] (2 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [236469] (1 PDB entry)

8. Domain d4neec1: 4nee C:72-203 [236471]
   Other proteins in same PDB: d4neec2, d4need_, d4neee2, d4neef_, d4neeh2, d4neei_, d4neek2, d4neel_
   automated match to d3ik5a_

Details for d4neec1

PDB Entry: 4nee, 2.88 Å

PDB Description: crystal structure of AP-2 alpha/simga2 complex bound to HIV-1 Nef

PDB Compounds: (C:) Protein Nef

SCOPe Domain Sequences for d4neec1:

Sequence; same for both SEQRES and ATOM records:

>d4neec1 d.102.1.0 (C:72-203) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pqvplrpmtykaavdlshflkekggleglihsqrrqdildlwiyhtqgyfpdwqnytpgp
gvrypltfgwcyklvpvepdkveeankgentsllhpvslhgmddperevlewrfdsrlaf
hhvarelhpeyf

Timeline for d4neec1:

• d4neec1 first appeared in SCOPe 2.03
  
• d4neec1 appears in SCOPe 2.07