Lineage for d1bu8a1 (1bu8 A:337-449)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2038801Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology
    duplication: has weak internal pseudo twofold symmetry
  4. 2038802Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) (S)
  5. 2038839Family b.12.1.2: Colipase-binding domain [49730] (1 protein)
    automatically mapped to Pfam PF01477
  6. 2038840Protein Pancreatic lipase, C-terminal domain [49731] (6 species)
  7. 2038852Species Norway rat (Rattus norvegicus) [TaxId:10116] [49737] (1 PDB entry)
    pancreatic lipase related protein 2
  8. 2038853Domain d1bu8a1: 1bu8 A:337-449 [23647]
    Other proteins in same PDB: d1bu8a2
    complexed with nag

Details for d1bu8a1

PDB Entry: 1bu8 (more details), 1.8 Å

PDB Description: rat pancreatic lipase related protein 2
PDB Compounds: (A:) protein (pancreatic lipase related protein 2)

SCOPe Domain Sequences for d1bu8a1:

Sequence, based on SEQRES records: (download)

>d1bu8a1 b.12.1.2 (A:337-449) Pancreatic lipase, C-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rwrykvsvtlsgakklsgyilvalygnngnskqyeifkgslkpearhvrdidvdinvgei
qkvkflwnnkvinlfrptlgasqitvqsgvdgkeynfcssdtvredvlqslypc

Sequence, based on observed residues (ATOM records): (download)

>d1bu8a1 b.12.1.2 (A:337-449) Pancreatic lipase, C-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rwrykvsvtlsgakklsgyilvalygnngnskqyeifkgslkpearhvrdidvdinvgei
qkvkflwnnrptlgasqitvqsgvdgkeynfcssdtvredvlqslypc

SCOPe Domain Coordinates for d1bu8a1:

Click to download the PDB-style file with coordinates for d1bu8a1.
(The format of our PDB-style files is described here.)

Timeline for d1bu8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bu8a2