Lineage for d4mhva_ (4mhv A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1272161Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1272162Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 1272285Family a.60.1.0: automated matches [191306] (1 protein)
    not a true family
  6. 1272286Protein automated matches [190031] (2 species)
    not a true protein
  7. 1272291Species Human (Homo sapiens) [TaxId:9606] [188353] (6 PDB entries)
  8. 1272302Domain d4mhva_: 4mhv A: [236463]
    automated match to d1sxda_
    complexed with act, ca, gol

Details for d4mhva_

PDB Entry: 4mhv (more details), 2.45 Å

PDB Description: Crystal structure of the PNT domain of human ETS2
PDB Compounds: (A:) protein c-ets-2

SCOPe Domain Sequences for d4mhva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mhva_ a.60.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avmsqalkatfsgfkkeqrrlgipknpwlwseqqvcqwllwatnefslvnvnlqrfgmng
qmlcnlgkerflelapdfvgdilwehleqmiken

SCOPe Domain Coordinates for d4mhva_:

Click to download the PDB-style file with coordinates for d4mhva_.
(The format of our PDB-style files is described here.)

Timeline for d4mhva_: