SCOPe 2.03: Domain d4mhvb_: 4mhv B:

Lineage for d4mhvb_ (4mhv B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.0: automated matches [191306] (1 protein)
   not a true family

6. Protein automated matches [190031] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188353] (6 PDB entries)

8. Domain d4mhvb_: 4mhv B: [236462]
   automated match to d1sxda_
   complexed with act, ca, gol

Details for d4mhvb_

PDB Entry: 4mhv, 2.45 Å

PDB Description: Crystal structure of the PNT domain of human ETS2

PDB Compounds: (B:) protein c-ets-2

SCOPe Domain Sequences for d4mhvb_:

Sequence; same for both SEQRES and ATOM records:

>d4mhvb_ a.60.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkavmsqalkatfsgfkkeqrrlgipknpwlwseqqvcqwllwatnefslvnvnlqrfgm
ngqmlcnlgkerflelapdfvgdilwehleqmiken

Timeline for d4mhvb_:

• d4mhvb_ is new in SCOPe 2.03-stable
  
• d4mhvb_ appears in SCOPe 2.04
  
• d4mhvb_ appears in the current release, SCOPe 2.08, called d4mhvb1