Lineage for d4mhvb1 (4mhv B:76-170)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715428Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 2715571Family a.60.1.0: automated matches [191306] (1 protein)
    not a true family
  6. 2715572Protein automated matches [190031] (3 species)
    not a true protein
  7. 2715581Species Human (Homo sapiens) [TaxId:9606] [188353] (24 PDB entries)
  8. 2715622Domain d4mhvb1: 4mhv B:76-170 [236462]
    Other proteins in same PDB: d4mhvb2
    automated match to d1sxda_
    complexed with act, ca, gol

Details for d4mhvb1

PDB Entry: 4mhv (more details), 2.45 Å

PDB Description: Crystal structure of the PNT domain of human ETS2
PDB Compounds: (B:) protein c-ets-2

SCOPe Domain Sequences for d4mhvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mhvb1 a.60.1.0 (B:76-170) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kavmsqalkatfsgfkkeqrrlgipknpwlwseqqvcqwllwatnefslvnvnlqrfgmn
gqmlcnlgkerflelapdfvgdilwehleqmiken

SCOPe Domain Coordinates for d4mhvb1:

Click to download the PDB-style file with coordinates for d4mhvb1.
(The format of our PDB-style files is described here.)

Timeline for d4mhvb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4mhvb2
View in 3D
Domains from other chains:
(mouse over for more information)
d4mhva_