Lineage for d1rp1_1 (1rp1 337-449)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11920Fold b.12: Lipase/lipooxygenase domain [49722] (1 superfamily)
  4. 11921Superfamily b.12.1: Lipase/lipooxygenase domain [49723] (3 families) (S)
  5. 11933Family b.12.1.2: Colipase-binding domain [49730] (1 protein)
  6. 11934Protein Pancreatic lipase, C-terminal domain [49731] (6 species)
  7. 11935Species Dog (Canis familiaris) [TaxId:9615] [49736] (1 PDB entry)
  8. 11936Domain d1rp1_1: 1rp1 337-449 [23646]
    Other proteins in same PDB: d1rp1_2

Details for d1rp1_1

PDB Entry: 1rp1 (more details), 2.1 Å

PDB Description: dog pancreatic lipase related protein 1

SCOP Domain Sequences for d1rp1_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rp1_1 b.12.1.2 (337-449) Pancreatic lipase, C-terminal domain {Dog (Canis familiaris)}
rwrygvsitlsgkratgqakvalfgskgnthqfnifkgilkpgsthsnefdakldvgtie
kvkflwnnnnptfpkvgaakitvqkgeektvhsfcsestvredvlltltpc

SCOP Domain Coordinates for d1rp1_1:

Click to download the PDB-style file with coordinates for d1rp1_1.
(The format of our PDB-style files is described here.)

Timeline for d1rp1_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rp1_2