Lineage for d1rp1_1 (1rp1 337-449)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.12: Lipase/lipooxygenase domain [49722] (1 superfamily) Superfamily b.12.1: Lipase/lipooxygenase domain [49723] (3 families) 
Family b.12.1.2: Colipase-binding domain [49730] (1 protein) Protein Pancreatic lipase, C-terminal domain [49731] (6 species) 
Species Dog (Canis familiaris) [TaxId:9615] [49736] (1 PDB entry) 
Domain d1rp1_1: 1rp1 337-449 [23646]
Other proteins in same PDB: d1rp1_2
Details for d1rp1_1
PDB Entry: 1rp1 (more details), 2.1 Å
PDB Description: dog pancreatic lipase related protein 1
SCOP Domain Sequences for d1rp1_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rp1_1 b.12.1.2 (337-449) Pancreatic lipase, C-terminal domain {Dog (Canis familiaris)}
rwrygvsitlsgkratgqakvalfgskgnthqfnifkgilkpgsthsnefdakldvgtie
kvkflwnnnnptfpkvgaakitvqkgeektvhsfcsestvredvlltltpc
SCOP Domain Coordinates for d1rp1_1:
Click to download the PDB-style file with coordinates for d1rp1_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rp1_1:
- d1rp1_1 appears in SCOP 1.57
- d1rp1_1 appears in the current release, SCOPe 2.08, called d1rp1a1
View in 3D
