Lineage for d1rp1a1 (1rp1 A:337-449)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2038801Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology
    duplication: has weak internal pseudo twofold symmetry
  4. 2038802Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) (S)
  5. 2038839Family b.12.1.2: Colipase-binding domain [49730] (1 protein)
    automatically mapped to Pfam PF01477
  6. 2038840Protein Pancreatic lipase, C-terminal domain [49731] (6 species)
  7. 2038841Species Dog (Canis familiaris) [TaxId:9615] [49736] (1 PDB entry)
    pancreatic lipase related protein 1
  8. 2038842Domain d1rp1a1: 1rp1 A:337-449 [23646]
    Other proteins in same PDB: d1rp1a2
    complexed with ca, nag

Details for d1rp1a1

PDB Entry: 1rp1 (more details), 2.1 Å

PDB Description: dog pancreatic lipase related protein 1
PDB Compounds: (A:) pancreatic lipase related protein 1

SCOPe Domain Sequences for d1rp1a1:

Sequence, based on SEQRES records: (download)

>d1rp1a1 b.12.1.2 (A:337-449) Pancreatic lipase, C-terminal domain {Dog (Canis familiaris) [TaxId: 9615]}
rwrygvsitlsgkratgqakvalfgskgnthqfnifkgilkpgsthsnefdakldvgtie
kvkflwnnnvvnptfpkvgaakitvqkgeektvhsfcsestvredvlltltpc

Sequence, based on observed residues (ATOM records): (download)

>d1rp1a1 b.12.1.2 (A:337-449) Pancreatic lipase, C-terminal domain {Dog (Canis familiaris) [TaxId: 9615]}
rwrygvsitlsgkratgqakvalfgskgnthqfnifkgilkpgsthsnefdakldvgtie
kvkflwnnnnptfpkvgaakitvqkgeektvhsfcsestvredvlltltpc

SCOPe Domain Coordinates for d1rp1a1:

Click to download the PDB-style file with coordinates for d1rp1a1.
(The format of our PDB-style files is described here.)

Timeline for d1rp1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rp1a2