![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
![]() | Domain d4llud2: 4llu D:110-209 [236457] Other proteins in same PDB: d4llua_, d4lluc_ automated match to d2hmic2 complexed with act, so4 |
PDB Entry: 4llu (more details), 2.16 Å
SCOPe Domain Sequences for d4llud2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4llud2 b.1.1.0 (D:110-209) automated matches {Human (Homo sapiens) [TaxId: 9606]} pkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqs nnkyaassylsltpeqwkshrsyscqvthegstvektvap
Timeline for d4llud2:
![]() Domains from other chains: (mouse over for more information) d4llua_, d4llub1, d4llub2, d4lluc_ |