SCOPe 2.08: Domain d4llud2: 4llu D:110-209

Lineage for d4llud2 (4llu D:110-209)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4llud2: 4llu D:110-209 [236457]
   Other proteins in same PDB: d4llua_, d4lluc_
   automated match to d2hmic2
   complexed with act, so4

Details for d4llud2

PDB Entry: 4llu, 2.16 Å

PDB Description: structure of pertuzumab fab with light chain clambda at 2.16a

PDB Compounds: (D:) Light chain CLAMBDA

SCOPe Domain Sequences for d4llud2:

Sequence; same for both SEQRES and ATOM records:

>d4llud2 b.1.1.0 (D:110-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqs
nnkyaassylsltpeqwkshrsyscqvthegstvektvap

Timeline for d4llud2:

• d4llud2 first appeared in SCOPe 2.03
  
• d4llud2 appears in SCOPe 2.07