![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.208: DhaL-like [101472] (1 superfamily) multihelical; bundle |
![]() | Superfamily a.208.1: DhaL-like [101473] (2 families) ![]() |
![]() | Family a.208.1.0: automated matches [191401] (1 protein) not a true family |
![]() | Protein automated matches [190529] (2 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [189603] (2 PDB entries) |
![]() | Domain d4lrzc1: 4lrz C:2-210 [236453] Other proteins in same PDB: d4lrza2, d4lrzb2, d4lrzc2, d4lrzd2 automated match to d3pnlb_ complexed with adp, mg |
PDB Entry: 4lrz (more details), 2.32 Å
SCOPe Domain Sequences for d4lrzc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lrzc1 a.208.1.0 (C:2-210) automated matches {Escherichia coli K-12 [TaxId: 83333]} slsrtqivnwltrcgdifsteseyltgldreigdadhglnmnrgfskvveklpaiadkdi gfilkntgmtllssvggasgplfgtffiraaqatqarqsltleelyqmfrdgadgvisrg kaepgdktmcdvwvpvveslrqsseqnlsvpvaleaassiaesaaqstitmqarkgrasy lgersighqdpgatsvmfmmqmlalaake
Timeline for d4lrzc1: