SCOPe 2.08: Domain d4lrzb1: 4lrz B:2-210

Lineage for d4lrzb1 (4lrz B:2-210)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.208: DhaL-like [101472] (1 superfamily)
   multihelical; bundle

4. Superfamily a.208.1: DhaL-like [101473] (2 families)

5. Family a.208.1.0: automated matches [191401] (1 protein)
   not a true family

6. Protein automated matches [190529] (2 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [189603] (2 PDB entries)

8. Domain d4lrzb1: 4lrz B:2-210 [236451]
   Other proteins in same PDB: d4lrza2, d4lrzb2, d4lrzc2, d4lrzd2
   automated match to d3pnlb_
   complexed with adp, mg

Details for d4lrzb1

PDB Entry: 4lrz, 2.32 Å

PDB Description: crystal structure of the e.coli dhar(n)-dhal complex

PDB Compounds: (B:) PTS-dependent dihydroxyacetone kinase, ADP-binding subunit dhaL

SCOPe Domain Sequences for d4lrzb1:

Sequence; same for both SEQRES and ATOM records:

>d4lrzb1 a.208.1.0 (B:2-210) automated matches {Escherichia coli K-12 [TaxId: 83333]}
slsrtqivnwltrcgdifsteseyltgldreigdadhglnmnrgfskvveklpaiadkdi
gfilkntgmtllssvggasgplfgtffiraaqatqarqsltleelyqmfrdgadgvisrg
kaepgdktmcdvwvpvveslrqsseqnlsvpvaleaassiaesaaqstitmqarkgrasy
lgersighqdpgatsvmfmmqmlalaake

Timeline for d4lrzb1:

• d4lrzb1 first appeared in SCOPe 2.03, called d4lrzb_
  
• d4lrzb1 appears in SCOPe 2.07