Lineage for d4lldb_ (4lld B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2754290Domain d4lldb_: 4lld B: [236448]
    automated match to d4jvua_

Details for d4lldb_

PDB Entry: 4lld (more details), 1.19 Å

PDB Description: Structure of wild-type IgG1 antibody heavy chain constant domain 1 and light chain lambda constant domain (IgG1 CH1:Clambda) at 1.19A
PDB Compounds: (B:) Ig lambda-2 chain C region

SCOPe Domain Sequences for d4lldb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lldb_ b.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvap

SCOPe Domain Coordinates for d4lldb_:

Click to download the PDB-style file with coordinates for d4lldb_.
(The format of our PDB-style files is described here.)

Timeline for d4lldb_: