![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.0: automated matches [191562] (1 protein) not a true family |
![]() | Protein automated matches [190976] (5 species) not a true protein |
![]() | Species Artificial gene [TaxId:32630] [233328] (6 PDB entries) |
![]() | Domain d4lpyb1: 4lpy B:3-93 [236447] Other proteins in same PDB: d4lpya2, d4lpyb2 automated match to d1tena_ complexed with na |
PDB Entry: 4lpy (more details), 1.92 Å
SCOPe Domain Sequences for d4lpyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lpyb1 b.1.2.0 (B:3-93) automated matches {Artificial gene [TaxId: 32630]} papknlvvsevtedslrlswtapdaafdsfliqyqesekvgeainltvpgsersydltgl kpgteytvsiygvfmkmslsksnplsaeftt
Timeline for d4lpyb1: