Lineage for d4lpya1 (4lpy A:2-93)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2371691Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2372249Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 2372250Protein automated matches [190976] (5 species)
    not a true protein
  7. 2372251Species Artificial gene [TaxId:32630] [233328] (6 PDB entries)
  8. 2372254Domain d4lpya1: 4lpy A:2-93 [236446]
    Other proteins in same PDB: d4lpya2, d4lpyb2
    automated match to d1tena_
    complexed with na

Details for d4lpya1

PDB Entry: 4lpy (more details), 1.92 Å

PDB Description: Crystal structure of TENCON variant G10
PDB Compounds: (A:) TENCON variant G10

SCOPe Domain Sequences for d4lpya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lpya1 b.1.2.0 (A:2-93) automated matches {Artificial gene [TaxId: 32630]}
lpapknlvvsevtedslrlswtapdaafdsfliqyqesekvgeainltvpgsersydltg
lkpgteytvsiygvfmkmslsksnplsaeftt

SCOPe Domain Coordinates for d4lpya1:

Click to download the PDB-style file with coordinates for d4lpya1.
(The format of our PDB-style files is described here.)

Timeline for d4lpya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4lpya2