SCOPe 2.08: Domain d4lpva1: 4lpv A:1-91

Lineage for d4lpva1 (4lpv A:1-91)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (5 species)
   not a true protein

7. Species Artificial gene [TaxId:32630] [233328] (6 PDB entries)

8. Domain d4lpva1: 4lpv A:1-91 [236445]
   Other proteins in same PDB: d4lpva2, d4lpvb2
   automated match to d2cuma1
   complexed with trs

Details for d4lpva1

PDB Entry: 4lpv, 1.8 Å

PDB Description: Crystal structure of TENCON variant P41BR3-42

PDB Compounds: (A:) TENCON variant P41BR3-42

SCOPe Domain Sequences for d4lpva1:

Sequence; same for both SEQRES and ATOM records:

>d4lpva1 b.1.2.0 (A:1-91) automated matches {Artificial gene [TaxId: 32630]}
mlpapknlvvsevtedslrlswtapdaafdsfmiqyqesekvgeainltvpgsersydlt
glkpgteytvsiygvlvvhkltfplsaeftt

Timeline for d4lpva1:

• d4lpva1 first appeared in SCOPe 2.03, called d4lpva_
  
• d4lpva1 appears in SCOPe 2.07