Lineage for d4lpxa1 (4lpx A:1-92)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2762239Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 2762240Protein automated matches [190976] (5 species)
    not a true protein
  7. 2762241Species Artificial gene [TaxId:32630] [233328] (6 PDB entries)
  8. 2762246Domain d4lpxa1: 4lpx A:1-92 [236442]
    Other proteins in same PDB: d4lpxa2
    automated match to d1tena_

Details for d4lpxa1

PDB Entry: 4lpx (more details), 1.9 Å

PDB Description: Crystal structure of TENCON variant D4
PDB Compounds: (A:) TENCON variant D4

SCOPe Domain Sequences for d4lpxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lpxa1 b.1.2.0 (A:1-92) automated matches {Artificial gene [TaxId: 32630]}
mlpapknlvvsevtedslrlswtapdaafdsfliqyqesekvgeainltvpgsersydlt
glkpgteytvsiygvlipfpnlsnplsaeftt

SCOPe Domain Coordinates for d4lpxa1:

Click to download the PDB-style file with coordinates for d4lpxa1.
(The format of our PDB-style files is described here.)

Timeline for d4lpxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4lpxa2